Placeholder image of a protein
Icon representing a puzzle

1627: Revisiting Puzzle 95: Chicken

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
January 23, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. Signals from the nervous system induce Ca2+ release within muscle cells. This muscle protein, which normally inhibits muscle contraction, changes shape in the presence of Ca2+ to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MVRCMKDDSKGKTEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 3 pts. 10,513
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 2 pts. 10,203
  3. Avatar for freefolder 13. freefolder 1 pt. 9,951
  4. Avatar for DW 2020 14. DW 2020 1 pt. 9,890
  5. Avatar for Coastal Biochemistry 15. Coastal Biochemistry 1 pt. 9,815
  6. Avatar for Mojo Risin' 16. Mojo Risin' 1 pt. 9,564
  7. Avatar for BIOC 402 17. BIOC 402 1 pt. 9,430
  8. Avatar for FoldIt@Netherlands 18. FoldIt@Netherlands 1 pt. 9,330
  9. Avatar for Team South Africa 19. Team South Africa 1 pt. 9,158
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 7,734
  1. Avatar for gdnskye 11. gdnskye Lv 1 73 pts. 10,662
  2. Avatar for Aubade01 12. Aubade01 Lv 1 70 pts. 10,660
  3. Avatar for ZeroLeak7 13. ZeroLeak7 Lv 1 68 pts. 10,659
  4. Avatar for fpc 14. fpc Lv 1 66 pts. 10,653
  5. Avatar for grogar7 15. grogar7 Lv 1 63 pts. 10,652
  6. Avatar for Marvelz 16. Marvelz Lv 1 61 pts. 10,636
  7. Avatar for NinjaGreg 17. NinjaGreg Lv 1 59 pts. 10,631
  8. Avatar for jausmh 18. jausmh Lv 1 57 pts. 10,624
  9. Avatar for actiasluna 19. actiasluna Lv 1 55 pts. 10,614
  10. Avatar for nicobul 20. nicobul Lv 1 53 pts. 10,605

Comments