Placeholder image of a protein
Icon representing a puzzle

1628: Unsolved De-novo Freestyle 144

Closed since about 7 years ago

Intermediate Overall Prediction

Summary

Created
January 24, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

TEEEAKKALAEAKKHVEEARRQGKSAEAEKEAQKAEKKGERHARRGTTRKPEELARRGADEAREEGKRME

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 9,926
  2. Avatar for HMT heritage 12. HMT heritage 1 pt. 9,895
  3. Avatar for freefolder 13. freefolder 1 pt. 9,313
  4. Avatar for Mojo Risin' 14. Mojo Risin' 1 pt. 9,276
  5. Avatar for DW 2020 15. DW 2020 1 pt. 9,265
  6. Avatar for Coastal Biochemistry 16. Coastal Biochemistry 1 pt. 8,537
  1. Avatar for Mark- 11. Mark- Lv 1 67 pts. 10,162
  2. Avatar for tyler0911 12. tyler0911 Lv 1 65 pts. 10,161
  3. Avatar for jobo0502 13. jobo0502 Lv 1 62 pts. 10,158
  4. Avatar for Timo van der Laan 14. Timo van der Laan Lv 1 59 pts. 10,138
  5. Avatar for Galaxie 15. Galaxie Lv 1 57 pts. 10,133
  6. Avatar for guineapig 16. guineapig Lv 1 54 pts. 10,125
  7. Avatar for dcrwheeler 17. dcrwheeler Lv 1 52 pts. 10,124
  8. Avatar for Vinara 18. Vinara Lv 1 50 pts. 10,106
  9. Avatar for vakobo 19. vakobo Lv 1 48 pts. 10,097
  10. Avatar for reefyrob 20. reefyrob Lv 1 46 pts. 10,095

Comments