Placeholder image of a protein
Icon representing a puzzle

1628: Unsolved De-novo Freestyle 144

Closed since about 7 years ago

Intermediate Overall Prediction

Summary

Created
January 24, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

TEEEAKKALAEAKKHVEEARRQGKSAEAEKEAQKAEKKGERHARRGTTRKPEELARRGADEAREEGKRME

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 9,926
  2. Avatar for HMT heritage 12. HMT heritage 1 pt. 9,895
  3. Avatar for freefolder 13. freefolder 1 pt. 9,313
  4. Avatar for Mojo Risin' 14. Mojo Risin' 1 pt. 9,276
  5. Avatar for DW 2020 15. DW 2020 1 pt. 9,265
  6. Avatar for Coastal Biochemistry 16. Coastal Biochemistry 1 pt. 8,537
  1. Avatar for spvincent 41. spvincent Lv 1 16 pts. 9,896
  2. Avatar for O Seki To 42. O Seki To Lv 1 15 pts. 9,895
  3. Avatar for isaksson 43. isaksson Lv 1 14 pts. 9,891
  4. Avatar for tarimo 44. tarimo Lv 1 14 pts. 9,881
  5. Avatar for johnmitch 45. johnmitch Lv 1 13 pts. 9,874
  6. Avatar for smilingone 46. smilingone Lv 1 12 pts. 9,844
  7. Avatar for jamiexq 47. jamiexq Lv 1 12 pts. 9,837
  8. Avatar for Blipperman 48. Blipperman Lv 1 11 pts. 9,824
  9. Avatar for mitarcher 49. mitarcher Lv 1 10 pts. 9,821
  10. Avatar for WBarme1234 50. WBarme1234 Lv 1 10 pts. 9,803

Comments