Placeholder image of a protein
Icon representing a puzzle

1628: Unsolved De-novo Freestyle 144

Closed since about 7 years ago

Intermediate Overall Prediction

Summary

Created
January 24, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

TEEEAKKALAEAKKHVEEARRQGKSAEAEKEAQKAEKKGERHARRGTTRKPEELARRGADEAREEGKRME

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 1 pt. 9,926
  2. Avatar for HMT heritage 12. HMT heritage 1 pt. 9,895
  3. Avatar for freefolder 13. freefolder 1 pt. 9,313
  4. Avatar for Mojo Risin' 14. Mojo Risin' 1 pt. 9,276
  5. Avatar for DW 2020 15. DW 2020 1 pt. 9,265
  6. Avatar for Coastal Biochemistry 16. Coastal Biochemistry 1 pt. 8,537
  1. Avatar for silent gene 51. silent gene Lv 1 9 pts. 9,797
  2. Avatar for manu8170 52. manu8170 Lv 1 9 pts. 9,793
  3. Avatar for pfirth 53. pfirth Lv 1 8 pts. 9,785
  4. Avatar for aznarog 54. aznarog Lv 1 8 pts. 9,785
  5. Avatar for alcor29 55. alcor29 Lv 1 7 pts. 9,763
  6. Avatar for Deleted player 56. Deleted player 7 pts. 9,758
  7. Avatar for diamonddays 57. diamonddays Lv 1 6 pts. 9,754
  8. Avatar for Alistair69 58. Alistair69 Lv 1 6 pts. 9,747
  9. Avatar for Merf 59. Merf Lv 1 6 pts. 9,733
  10. Avatar for alwen 60. alwen Lv 1 5 pts. 9,725

Comments