Placeholder image of a protein
Icon representing a puzzle

1630: Revisiting Puzzle 96: Collagen

Closed since about 7 years ago

Novice Overall Prediction

Summary


Created
January 30, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups


  1. Avatar for Rechenkraft.net 21. Rechenkraft.net 1 pt. 3,129

  1. Avatar for christioanchauvin 31. christioanchauvin Lv 1 37 pts. 9,832
  2. Avatar for O Seki To 32. O Seki To Lv 1 36 pts. 9,831
  3. Avatar for fpc 33. fpc Lv 1 35 pts. 9,831
  4. Avatar for dcrwheeler 34. dcrwheeler Lv 1 34 pts. 9,827
  5. Avatar for vakobo 35. vakobo Lv 1 32 pts. 9,811
  6. Avatar for Marvelz 36. Marvelz Lv 1 31 pts. 9,808
  7. Avatar for Glen B 37. Glen B Lv 1 30 pts. 9,806
  8. Avatar for aznarog 38. aznarog Lv 1 29 pts. 9,793
  9. Avatar for YeshuaLives 39. YeshuaLives Lv 1 28 pts. 9,791
  10. Avatar for Crossed Sticks 40. Crossed Sticks Lv 1 27 pts. 9,790

Comments