Placeholder image of a protein
Icon representing a puzzle

1630: Revisiting Puzzle 96: Collagen

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
January 30, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,211
  2. Avatar for Beta Folders 2. Beta Folders 78 pts. 10,210
  3. Avatar for Gargleblasters 3. Gargleblasters 60 pts. 10,167
  4. Avatar for Go Science 4. Go Science 45 pts. 10,107
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 33 pts. 10,099
  6. Avatar for Marvin's bunch 6. Marvin's bunch 24 pts. 10,060
  7. Avatar for Contenders 7. Contenders 17 pts. 9,985
  8. Avatar for Void Crushers 8. Void Crushers 12 pts. 9,944
  9. Avatar for HMT heritage 9. HMT heritage 8 pts. 9,831
  10. Avatar for Russian team 10. Russian team 6 pts. 9,811
  1. Avatar for alanshark 91. alanshark Lv 1 3 pts. 8,918
  2. Avatar for hexidecimalhack 92. hexidecimalhack Lv 1 2 pts. 8,913
  3. Avatar for sydlg19 93. sydlg19 Lv 1 2 pts. 8,884
  4. Avatar for BlackyAlex 94. BlackyAlex Lv 1 2 pts. 8,881
  5. Avatar for RyeSnake 95. RyeSnake Lv 1 2 pts. 8,880
  6. Avatar for Znaika 96. Znaika Lv 1 2 pts. 8,859
  7. Avatar for Lyshi2018 97. Lyshi2018 Lv 1 2 pts. 8,852
  8. Avatar for lvanonse 98. lvanonse Lv 1 2 pts. 8,847
  9. Avatar for rinze 99. rinze Lv 1 2 pts. 8,822
  10. Avatar for Altercomp 100. Altercomp Lv 1 2 pts. 8,819

Comments