Placeholder image of a protein
Icon representing a puzzle

1631: Unsolved De-novo Freestyle 145

Closed since about 7 years ago

Intermediate Overall Prediction

Summary

Created
January 30, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

TIDDARKEIRWWARYYEKLLRMWKKIKGIEDELWKYFEKYLKEFWQWVLEAMKKFKYEEAEKRFREEFKLGEKWLREAVK

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 1 pt. 9,331
  2. Avatar for FoldIt@Poland 12. FoldIt@Poland 1 pt. 8,967
  3. Avatar for Richard Dawkins Foundation 13. Richard Dawkins Foundation 1 pt. 8,798
  4. Avatar for DW 2020 14. DW 2020 1 pt. 8,666
  5. Avatar for BIOF215 15. BIOF215 1 pt. 6,809
  6. Avatar for Coastal Biochemistry 16. Coastal Biochemistry 1 pt. 5,891
  7. Avatar for Italiani Al Lavoro 17. Italiani Al Lavoro 1 pt. 5,884
  1. Avatar for Knoblerine 91. Knoblerine Lv 1 2 pts. 8,941
  2. Avatar for YeshuaLives 92. YeshuaLives Lv 1 2 pts. 8,937
  3. Avatar for Maerlyn138 93. Maerlyn138 Lv 1 2 pts. 8,930
  4. Avatar for Znaika 94. Znaika Lv 1 2 pts. 8,909
  5. Avatar for sydlg19 95. sydlg19 Lv 1 2 pts. 8,824
  6. Avatar for NotJim99 96. NotJim99 Lv 1 2 pts. 8,802
  7. Avatar for nathanmills 97. nathanmills Lv 1 2 pts. 8,798
  8. Avatar for rinze 98. rinze Lv 1 2 pts. 8,756
  9. Avatar for Bautho 99. Bautho Lv 1 2 pts. 8,719
  10. Avatar for ourtown 100. ourtown Lv 1 1 pt. 8,714

Comments