Placeholder image of a protein
Icon representing a puzzle

1631: Unsolved De-novo Freestyle 145

Closed since about 7 years ago

Intermediate Overall Prediction

Summary

Created
January 30, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

TIDDARKEIRWWARYYEKLLRMWKKIKGIEDELWKYFEKYLKEFWQWVLEAMKKFKYEEAEKRFREEFKLGEKWLREAVK

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 1 pt. 9,331
  2. Avatar for FoldIt@Poland 12. FoldIt@Poland 1 pt. 8,967
  3. Avatar for Richard Dawkins Foundation 13. Richard Dawkins Foundation 1 pt. 8,798
  4. Avatar for DW 2020 14. DW 2020 1 pt. 8,666
  5. Avatar for BIOF215 15. BIOF215 1 pt. 6,809
  6. Avatar for Coastal Biochemistry 16. Coastal Biochemistry 1 pt. 5,891
  7. Avatar for Italiani Al Lavoro 17. Italiani Al Lavoro 1 pt. 5,884
  1. Avatar for lconor 111. lconor Lv 1 1 pt. 8,037
  2. Avatar for maur9357 112. maur9357 Lv 1 1 pt. 8,005
  3. Avatar for Susume 113. Susume Lv 1 1 pt. 7,776
  4. Avatar for NR22 114. NR22 Lv 1 1 pt. 7,763
  5. Avatar for henur 115. henur Lv 1 1 pt. 7,655
  6. Avatar for altejoh 116. altejoh Lv 1 1 pt. 7,610
  7. Avatar for srrao2019 117. srrao2019 Lv 1 1 pt. 7,600
  8. Avatar for luwachamo 118. luwachamo Lv 1 1 pt. 7,455
  9. Avatar for kvasirthewise 119. kvasirthewise Lv 1 1 pt. 7,253
  10. Avatar for okolan 120. okolan Lv 1 1 pt. 7,128

Comments