Placeholder image of a protein
Icon representing a puzzle

1631: Unsolved De-novo Freestyle 145

Closed since about 7 years ago

Intermediate Overall Prediction

Summary

Created
January 30, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

TIDDARKEIRWWARYYEKLLRMWKKIKGIEDELWKYFEKYLKEFWQWVLEAMKKFKYEEAEKRFREEFKLGEKWLREAVK

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 1 pt. 9,331
  2. Avatar for FoldIt@Poland 12. FoldIt@Poland 1 pt. 8,967
  3. Avatar for Richard Dawkins Foundation 13. Richard Dawkins Foundation 1 pt. 8,798
  4. Avatar for DW 2020 14. DW 2020 1 pt. 8,666
  5. Avatar for BIOF215 15. BIOF215 1 pt. 6,809
  6. Avatar for Coastal Biochemistry 16. Coastal Biochemistry 1 pt. 5,891
  7. Avatar for Italiani Al Lavoro 17. Italiani Al Lavoro 1 pt. 5,884
  1. Avatar for ORne the SaiLoR 131. ORne the SaiLoR Lv 1 1 pt. 6,090
  2. Avatar for 01010011111 132. 01010011111 Lv 1 1 pt. 6,081
  3. Avatar for 0571 133. 0571 Lv 1 1 pt. 6,079
  4. Avatar for Agent19 134. Agent19 Lv 1 1 pt. 5,988
  5. Avatar for jamiecooksey 135. jamiecooksey Lv 1 1 pt. 5,960
  6. Avatar for RootBeerSwordsman 136. RootBeerSwordsman Lv 1 1 pt. 5,899
  7. Avatar for caseymcdonald 137. caseymcdonald Lv 1 1 pt. 5,891
  8. Avatar for Ciccillo 138. Ciccillo Lv 1 1 pt. 5,884
  9. Avatar for rishi_veer 139. rishi_veer Lv 1 1 pt. 5,799
  10. Avatar for rushil_gupta 140. rushil_gupta Lv 1 1 pt. 5,687

Comments