Placeholder image of a protein
Icon representing a puzzle

1631: Unsolved De-novo Freestyle 145

Closed since about 7 years ago

Intermediate Overall Prediction

Summary

Created
January 30, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

TIDDARKEIRWWARYYEKLLRMWKKIKGIEDELWKYFEKYLKEFWQWVLEAMKKFKYEEAEKRFREEFKLGEKWLREAVK

Top groups

  1. Avatar for HMT heritage 11. HMT heritage 1 pt. 9,331
  2. Avatar for FoldIt@Poland 12. FoldIt@Poland 1 pt. 8,967
  3. Avatar for Richard Dawkins Foundation 13. Richard Dawkins Foundation 1 pt. 8,798
  4. Avatar for DW 2020 14. DW 2020 1 pt. 8,666
  5. Avatar for BIOF215 15. BIOF215 1 pt. 6,809
  6. Avatar for Coastal Biochemistry 16. Coastal Biochemistry 1 pt. 5,891
  7. Avatar for Italiani Al Lavoro 17. Italiani Al Lavoro 1 pt. 5,884
  1. Avatar for vizhu2018 161. vizhu2018 Lv 1 1 pt. 0
  2. Avatar for jaredmason24 162. jaredmason24 Lv 1 1 pt. 0
  3. Avatar for multaq 163. multaq Lv 1 1 pt. 0
  4. Avatar for Hollinas 164. Hollinas Lv 1 1 pt. 0
  5. Avatar for anku 165. anku Lv 1 1 pt. 0

Comments