Placeholder image of a protein
Icon representing a puzzle

1631: Unsolved De-novo Freestyle 145

Closed since about 7 years ago

Intermediate Overall Prediction

Summary


Created
January 30, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

TIDDARKEIRWWARYYEKLLRMWKKIKGIEDELWKYFEKYLKEFWQWVLEAMKKFKYEEAEKRFREEFKLGEKWLREAVK

Top groups


  1. Avatar for HMT heritage 11. HMT heritage 1 pt. 9,331
  2. Avatar for FoldIt@Poland 12. FoldIt@Poland 1 pt. 8,967
  3. Avatar for DW 2020 14. DW 2020 1 pt. 8,666
  4. Avatar for BIOF215 15. BIOF215 1 pt. 6,809
  5. Avatar for Coastal Biochemistry 16. Coastal Biochemistry 1 pt. 5,891
  6. Avatar for Italiani Al Lavoro 17. Italiani Al Lavoro 1 pt. 5,884

  1. Avatar for TastyMunchies 61. TastyMunchies Lv 1 11 pts. 9,691
  2. Avatar for jausmh 62. jausmh Lv 1 10 pts. 9,689
  3. Avatar for Blipperman 63. Blipperman Lv 1 10 pts. 9,674
  4. Avatar for Merf 64. Merf Lv 1 9 pts. 9,658
  5. Avatar for NinjaGreg 65. NinjaGreg Lv 1 9 pts. 9,626
  6. Avatar for alcor29 66. alcor29 Lv 1 9 pts. 9,618
  7. Avatar for PlagueRat 67. PlagueRat Lv 1 8 pts. 9,609
  8. Avatar for cbwest 68. cbwest Lv 1 8 pts. 9,607
  9. Avatar for fisherlr777 69. fisherlr777 Lv 1 7 pts. 9,554
  10. Avatar for MrZanav 70. MrZanav Lv 1 7 pts. 9,537

Comments