Placeholder image of a protein
Icon representing a puzzle

1631: Unsolved De-novo Freestyle 145

Closed since about 7 years ago

Intermediate Overall Prediction

Summary

Created
January 30, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

TIDDARKEIRWWARYYEKLLRMWKKIKGIEDELWKYFEKYLKEFWQWVLEAMKKFKYEEAEKRFREEFKLGEKWLREAVK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,617
  2. Avatar for Hold My Beer 2. Hold My Beer 73 pts. 10,538
  3. Avatar for Beta Folders 3. Beta Folders 52 pts. 10,516
  4. Avatar for Go Science 4. Go Science 36 pts. 10,457
  5. Avatar for Russian team 5. Russian team 24 pts. 10,381
  6. Avatar for Contenders 6. Contenders 16 pts. 10,365
  7. Avatar for Void Crushers 7. Void Crushers 10 pts. 10,323
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 6 pts. 10,304
  9. Avatar for Gargleblasters 9. Gargleblasters 4 pts. 10,231
  10. Avatar for Marvin's bunch 10. Marvin's bunch 2 pts. 10,202
  1. Avatar for rahuls 151. rahuls Lv 1 1 pt. 0
  2. Avatar for lionium 152. lionium Lv 1 1 pt. 0
  3. Avatar for mbinfield 153. mbinfield Lv 1 1 pt. 0
  4. Avatar for lamoille 154. lamoille Lv 1 1 pt. 0
  5. Avatar for shashwatmishra776 155. shashwatmishra776 Lv 1 1 pt. 0
  6. Avatar for Idiotboy 156. Idiotboy Lv 1 1 pt. 0
  7. Avatar for rish5555 157. rish5555 Lv 1 1 pt. 0
  8. Avatar for HimSha 158. HimSha Lv 1 1 pt. 0
  9. Avatar for apoorvb 159. apoorvb Lv 1 1 pt. 0
  10. Avatar for Riju1998 160. Riju1998 Lv 1 1 pt. 0

Comments