Placeholder image of a protein
Icon representing a puzzle

1631: Unsolved De-novo Freestyle 145

Closed since about 7 years ago

Intermediate Overall Prediction

Summary

Created
January 30, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

TIDDARKEIRWWARYYEKLLRMWKKIKGIEDELWKYFEKYLKEFWQWVLEAMKKFKYEEAEKRFREEFKLGEKWLREAVK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,617
  2. Avatar for Hold My Beer 2. Hold My Beer 73 pts. 10,538
  3. Avatar for Beta Folders 3. Beta Folders 52 pts. 10,516
  4. Avatar for Go Science 4. Go Science 36 pts. 10,457
  5. Avatar for Russian team 5. Russian team 24 pts. 10,381
  6. Avatar for Contenders 6. Contenders 16 pts. 10,365
  7. Avatar for Void Crushers 7. Void Crushers 10 pts. 10,323
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 6 pts. 10,304
  9. Avatar for Gargleblasters 9. Gargleblasters 4 pts. 10,231
  10. Avatar for Marvin's bunch 10. Marvin's bunch 2 pts. 10,202
  1. Avatar for yavij2019 121. yavij2019 Lv 1 1 pt. 7,033
  2. Avatar for jjdrich492 122. jjdrich492 Lv 1 1 pt. 7,006
  3. Avatar for wouterenkinga 123. wouterenkinga Lv 1 1 pt. 6,857
  4. Avatar for f20160590 124. f20160590 Lv 1 1 pt. 6,809
  5. Avatar for kerpowah 125. kerpowah Lv 1 1 pt. 6,753
  6. Avatar for murdock88 126. murdock88 Lv 1 1 pt. 6,582
  7. Avatar for Willyanto 127. Willyanto Lv 1 1 pt. 6,448
  8. Avatar for C o n s u m e 128. C o n s u m e Lv 1 1 pt. 6,341
  9. Avatar for anli2019 129. anli2019 Lv 1 1 pt. 6,281
  10. Avatar for Calvers 130. Calvers Lv 1 1 pt. 6,201

Comments