Placeholder image of a protein
Icon representing a puzzle

1633: Revisiting Puzzle 97: Pig

Closed since about 7 years ago

Novice Overall Prediction

Summary


Created
February 05, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups


  1. Avatar for HMT heritage 11. HMT heritage 4 pts. 10,124
  2. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 2 pts. 10,041
  3. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 9,927
  4. Avatar for DW 2020 15. DW 2020 1 pt. 9,810
  5. Avatar for Deleted group 16. Deleted group pts. 9,609
  6. Avatar for freefolder 17. freefolder 1 pt. 9,580
  7. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 9,489
  8. Avatar for FoldIt@Poland 19. FoldIt@Poland 1 pt. 9,485
  9. Avatar for BIOF215 20. BIOF215 1 pt. 9,294

  1. Avatar for Aps1997 151. Aps1997 Lv 1 1 pt. 8,708
  2. Avatar for Rudrraksh 152. Rudrraksh Lv 1 1 pt. 8,703
  3. Avatar for 0571 153. 0571 Lv 1 1 pt. 8,702
  4. Avatar for shubhamt 154. shubhamt Lv 1 1 pt. 8,702
  5. Avatar for ashish4197 155. ashish4197 Lv 1 1 pt. 8,696
  6. Avatar for anli2019 156. anli2019 Lv 1 1 pt. 8,692
  7. Avatar for anku 157. anku Lv 1 1 pt. 8,677
  8. Avatar for avp 158. avp Lv 1 1 pt. 8,676
  9. Avatar for VICTORmolecular 159. VICTORmolecular Lv 1 1 pt. 8,670
  10. Avatar for Ricardo Oliveira 160. Ricardo Oliveira Lv 1 1 pt. 8,660

Comments