Placeholder image of a protein
Icon representing a puzzle

1633: Revisiting Puzzle 97: Pig

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
February 05, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 11,075
  2. Avatar for Contenders 2. Contenders 78 pts. 11,032
  3. Avatar for Void Crushers 3. Void Crushers 60 pts. 11,030
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 45 pts. 10,967
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 33 pts. 10,940
  6. Avatar for Go Science 6. Go Science 24 pts. 10,891
  7. Avatar for Marvin's bunch 7. Marvin's bunch 17 pts. 10,848
  8. Avatar for Gargleblasters 8. Gargleblasters 12 pts. 10,809
  9. Avatar for Russian team 9. Russian team 8 pts. 10,757
  10. Avatar for Hold My Beer 10. Hold My Beer 6 pts. 10,215
  1. Avatar for Aps1997 151. Aps1997 Lv 1 1 pt. 8,708
  2. Avatar for Rudrraksh 152. Rudrraksh Lv 1 1 pt. 8,703
  3. Avatar for 0571 153. 0571 Lv 1 1 pt. 8,702
  4. Avatar for shubhamt 154. shubhamt Lv 1 1 pt. 8,702
  5. Avatar for ashish4197 155. ashish4197 Lv 1 1 pt. 8,696
  6. Avatar for anli2019 156. anli2019 Lv 1 1 pt. 8,692
  7. Avatar for anku 157. anku Lv 1 1 pt. 8,677
  8. Avatar for avp 158. avp Lv 1 1 pt. 8,676
  9. Avatar for VICTORmolecular 159. VICTORmolecular Lv 1 1 pt. 8,670
  10. Avatar for Ricardo Oliveira 160. Ricardo Oliveira Lv 1 1 pt. 8,660

Comments