Placeholder image of a protein
Icon representing a puzzle

1633: Revisiting Puzzle 97: Pig

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
February 05, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups

  1. Avatar for Coastal Biochemistry 21. Coastal Biochemistry 1 pt. 9,176
  1. Avatar for pi r squared 111. pi r squared Lv 1 2 pts. 9,419
  2. Avatar for SiPot2018 112. SiPot2018 Lv 1 2 pts. 9,410
  3. Avatar for Knoblerine 113. Knoblerine Lv 1 2 pts. 9,390
  4. Avatar for pielie 114. pielie Lv 1 2 pts. 9,367
  5. Avatar for Lyshi2018 115. Lyshi2018 Lv 1 2 pts. 9,296
  6. Avatar for rahuls 116. rahuls Lv 1 2 pts. 9,294
  7. Avatar for alwan2018 117. alwan2018 Lv 1 1 pt. 9,289
  8. Avatar for Vincera 118. Vincera Lv 1 1 pt. 9,259
  9. Avatar for atlas100 119. atlas100 Lv 1 1 pt. 9,250
  10. Avatar for erexer 120. erexer Lv 1 1 pt. 9,243

Comments