Placeholder image of a protein
Icon representing a puzzle

1633: Revisiting Puzzle 97: Pig

Closed since over 7 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
February 05, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups


  1. Avatar for Beta Folders 100 pts. 11,075
  2. Avatar for Contenders 2. Contenders 78 pts. 11,032
  3. Avatar for Void Crushers 3. Void Crushers 60 pts. 11,030
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 45 pts. 10,967
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 33 pts. 10,940
  6. Avatar for Go Science 6. Go Science 24 pts. 10,891
  7. Avatar for Marvin's bunch 7. Marvin's bunch 17 pts. 10,848
  8. Avatar for Gargleblasters 8. Gargleblasters 12 pts. 10,809
  9. Avatar for Russian team 9. Russian team 8 pts. 10,757
  10. Avatar for Hold My Beer 10. Hold My Beer 6 pts. 10,215

  1. Avatar for pi r squared 111. pi r squared Lv 1 2 pts. 9,419
  2. Avatar for SiPot2018 112. SiPot2018 Lv 1 2 pts. 9,410
  3. Avatar for Knoblerine 113. Knoblerine Lv 1 2 pts. 9,390
  4. Avatar for pielie 114. pielie Lv 1 2 pts. 9,367
  5. Avatar for Lyshi2018 115. Lyshi2018 Lv 1 2 pts. 9,296
  6. Avatar for rahuls 116. rahuls Lv 1 2 pts. 9,294
  7. Avatar for alwan2018 117. alwan2018 Lv 1 1 pt. 9,289
  8. Avatar for Vincera 118. Vincera Lv 1 1 pt. 9,259
  9. Avatar for atlas100 119. atlas100 Lv 1 1 pt. 9,250
  10. Avatar for erexer 120. erexer Lv 1 1 pt. 9,243

Comments