Placeholder image of a protein
Icon representing a puzzle

1636: Revisiting Puzzle 109: Pumpkin

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
February 12, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups

  1. Avatar for Hold My Beer 11. Hold My Beer 5 pts. 8,843
  2. Avatar for freefolder 12. freefolder 4 pts. 8,808
  3. Avatar for Italiani Al Lavoro 13. Italiani Al Lavoro 2 pts. 8,781
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 2 pts. 8,765
  5. Avatar for DW 2020 15. DW 2020 1 pt. 8,713
  6. Avatar for GENE 433 16. GENE 433 1 pt. 8,709
  7. Avatar for FoldIt@Poland 17. FoldIt@Poland 1 pt. 8,657
  8. Avatar for Team South Africa 18. Team South Africa 1 pt. 8,305
  9. Avatar for Dutch Power Cows 19. Dutch Power Cows 1 pt. 8,293
  10. Avatar for Team Schleswig-Holstein 20. Team Schleswig-Holstein 1 pt. 8,208
  1. Avatar for grogar7 21. grogar7 Lv 1 52 pts. 9,075
  2. Avatar for Timo van der Laan 22. Timo van der Laan Lv 1 50 pts. 9,057
  3. Avatar for orily1337 23. orily1337 Lv 1 48 pts. 9,052
  4. Avatar for DodoBird 24. DodoBird Lv 1 47 pts. 9,052
  5. Avatar for TastyMunchies 25. TastyMunchies Lv 1 45 pts. 9,043
  6. Avatar for fpc 26. fpc Lv 1 43 pts. 9,032
  7. Avatar for Skippysk8s 27. Skippysk8s Lv 1 42 pts. 9,030
  8. Avatar for vakobo 28. vakobo Lv 1 40 pts. 9,006
  9. Avatar for Deleted player 29. Deleted player 39 pts. 9,004
  10. Avatar for jausmh 30. jausmh Lv 1 37 pts. 8,996

Comments