Placeholder image of a protein
Icon representing a puzzle

1639: Revisiting Puzzle 110: Turkey

Closed since about 7 years ago

Novice Overall Prediction

Summary


Created
February 20, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups


  1. Avatar for Marvin's bunch 11. Marvin's bunch 4 pts. 10,160
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 2 pts. 9,954
  3. Avatar for GENE 433 13. GENE 433 2 pts. 9,828
  4. Avatar for FoldIt@Poland 14. FoldIt@Poland 1 pt. 9,825
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 9,620
  6. Avatar for DW 2020 16. DW 2020 1 pt. 9,470
  7. Avatar for Team South Africa 17. Team South Africa 1 pt. 8,824
  8. Avatar for Dutch Power Cows 18. Dutch Power Cows 1 pt. 8,359

  1. Avatar for rabamino12358 91. rabamino12358 Lv 1 2 pts. 9,550
  2. Avatar for Knoblerine 92. Knoblerine Lv 1 2 pts. 9,543
  3. Avatar for PlagueRat 93. PlagueRat Lv 1 2 pts. 9,518
  4. Avatar for pfirth 94. pfirth Lv 1 2 pts. 9,499
  5. Avatar for jeremiasivan 95. jeremiasivan Lv 1 2 pts. 9,499
  6. Avatar for rinze 96. rinze Lv 1 2 pts. 9,482
  7. Avatar for ehhan2018 97. ehhan2018 Lv 1 1 pt. 9,470
  8. Avatar for Steven Pletsch 98. Steven Pletsch Lv 1 1 pt. 9,461
  9. Avatar for Wojcimierz 99. Wojcimierz Lv 1 1 pt. 9,456
  10. Avatar for dbuske 100. dbuske Lv 1 1 pt. 9,428

Comments