Placeholder image of a protein
Icon representing a puzzle

1639: Revisiting Puzzle 110: Turkey

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
February 20, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,550
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 78 pts. 10,495
  3. Avatar for Go Science 3. Go Science 60 pts. 10,483
  4. Avatar for Gargleblasters 4. Gargleblasters 45 pts. 10,390
  5. Avatar for Russian team 5. Russian team 33 pts. 10,347
  6. Avatar for HMT heritage 6. HMT heritage 24 pts. 10,335
  7. Avatar for Void Crushers 7. Void Crushers 17 pts. 10,324
  8. Avatar for Contenders 8. Contenders 12 pts. 10,308
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 8 pts. 10,256
  10. Avatar for Hold My Beer 10. Hold My Beer 6 pts. 10,233
  1. Avatar for rabamino12358 91. rabamino12358 Lv 1 2 pts. 9,550
  2. Avatar for Knoblerine 92. Knoblerine Lv 1 2 pts. 9,543
  3. Avatar for PlagueRat 93. PlagueRat Lv 1 2 pts. 9,518
  4. Avatar for pfirth 94. pfirth Lv 1 2 pts. 9,499
  5. Avatar for jeremiasivan 95. jeremiasivan Lv 1 2 pts. 9,499
  6. Avatar for rinze 96. rinze Lv 1 2 pts. 9,482
  7. Avatar for ehhan2018 97. ehhan2018 Lv 1 1 pt. 9,470
  8. Avatar for Steven Pletsch 98. Steven Pletsch Lv 1 1 pt. 9,461
  9. Avatar for Wojcimierz 99. Wojcimierz Lv 1 1 pt. 9,456
  10. Avatar for dbuske 100. dbuske Lv 1 1 pt. 9,428

Comments