Placeholder image of a protein
Icon representing a puzzle

1639: Revisiting Puzzle 110: Turkey

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
February 20, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Marvin's bunch 11. Marvin's bunch 4 pts. 10,160
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 2 pts. 9,954
  3. Avatar for GENE 433 13. GENE 433 2 pts. 9,828
  4. Avatar for FoldIt@Poland 14. FoldIt@Poland 1 pt. 9,825
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 9,620
  6. Avatar for DW 2020 16. DW 2020 1 pt. 9,470
  7. Avatar for Team South Africa 17. Team South Africa 1 pt. 8,824
  8. Avatar for Dutch Power Cows 18. Dutch Power Cows 1 pt. 8,359
  9. Avatar for Team Schleswig-Holstein 19. Team Schleswig-Holstein 1 pt. 7,939
  10. Avatar for Rice Biochemistry 301 2020_2021 20. Rice Biochemistry 301 2020_2021 1 pt. 5,122
  1. Avatar for 01010011111 151. 01010011111 Lv 1 1 pt. 7,222
  2. Avatar for Holyaws 152. Holyaws Lv 1 1 pt. 6,770
  3. Avatar for phi16 153. phi16 Lv 1 1 pt. 6,330
  4. Avatar for Gemmer0 154. Gemmer0 Lv 1 1 pt. 6,318
  5. Avatar for 4030_18_Szyca 155. 4030_18_Szyca Lv 1 1 pt. 5,122
  6. Avatar for Allen Tao 156. Allen Tao Lv 1 1 pt. 5,122
  7. Avatar for Samuelferreira8 157. Samuelferreira8 Lv 1 1 pt. 5,122
  8. Avatar for bkoep 158. bkoep Lv 1 1 pt. 5,122
  9. Avatar for 4030_18_AbbyS 159. 4030_18_AbbyS Lv 1 1 pt. 5,122

Comments