Placeholder image of a protein
Icon representing a puzzle

1639: Revisiting Puzzle 110: Turkey

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
February 20, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Marvin's bunch 11. Marvin's bunch 4 pts. 10,160
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 2 pts. 9,954
  3. Avatar for GENE 433 13. GENE 433 2 pts. 9,828
  4. Avatar for FoldIt@Poland 14. FoldIt@Poland 1 pt. 9,825
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 9,620
  6. Avatar for DW 2020 16. DW 2020 1 pt. 9,470
  7. Avatar for Team South Africa 17. Team South Africa 1 pt. 8,824
  8. Avatar for Dutch Power Cows 18. Dutch Power Cows 1 pt. 8,359
  9. Avatar for Team Schleswig-Holstein 19. Team Schleswig-Holstein 1 pt. 7,939
  10. Avatar for Rice Biochemistry 301 2020_2021 20. Rice Biochemistry 301 2020_2021 1 pt. 5,122
  1. Avatar for kvasirthewise 81. kvasirthewise Lv 1 3 pts. 9,685
  2. Avatar for @lison 82. @lison Lv 1 3 pts. 9,681
  3. Avatar for MrZanav 83. MrZanav Lv 1 3 pts. 9,675
  4. Avatar for heather-1 84. heather-1 Lv 1 3 pts. 9,665
  5. Avatar for alcor29 85. alcor29 Lv 1 3 pts. 9,651
  6. Avatar for JasperD 86. JasperD Lv 1 3 pts. 9,620
  7. Avatar for carsonfb 87. carsonfb Lv 1 2 pts. 9,610
  8. Avatar for Hellcat6 88. Hellcat6 Lv 1 2 pts. 9,575
  9. Avatar for RyeSnake 89. RyeSnake Lv 1 2 pts. 9,566
  10. Avatar for hexidecimalhack 90. hexidecimalhack Lv 1 2 pts. 9,554

Comments