Placeholder image of a protein
Icon representing a puzzle

1639: Revisiting Puzzle 110: Turkey

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
February 20, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,550
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 78 pts. 10,495
  3. Avatar for Go Science 3. Go Science 60 pts. 10,483
  4. Avatar for Gargleblasters 4. Gargleblasters 45 pts. 10,390
  5. Avatar for Russian team 5. Russian team 33 pts. 10,347
  6. Avatar for HMT heritage 6. HMT heritage 24 pts. 10,335
  7. Avatar for Void Crushers 7. Void Crushers 17 pts. 10,324
  8. Avatar for Contenders 8. Contenders 12 pts. 10,308
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 8 pts. 10,256
  10. Avatar for Hold My Beer 10. Hold My Beer 6 pts. 10,233
  1. Avatar for kvasirthewise 81. kvasirthewise Lv 1 3 pts. 9,685
  2. Avatar for @lison 82. @lison Lv 1 3 pts. 9,681
  3. Avatar for MrZanav 83. MrZanav Lv 1 3 pts. 9,675
  4. Avatar for heather-1 84. heather-1 Lv 1 3 pts. 9,665
  5. Avatar for alcor29 85. alcor29 Lv 1 3 pts. 9,651
  6. Avatar for JasperD 86. JasperD Lv 1 3 pts. 9,620
  7. Avatar for carsonfb 87. carsonfb Lv 1 2 pts. 9,610
  8. Avatar for Hellcat6 88. Hellcat6 Lv 1 2 pts. 9,575
  9. Avatar for RyeSnake 89. RyeSnake Lv 1 2 pts. 9,566
  10. Avatar for hexidecimalhack 90. hexidecimalhack Lv 1 2 pts. 9,554

Comments