Placeholder image of a protein
Icon representing a puzzle

1642: Revisiting Puzzle 111: Mouse

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
February 27, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups

  1. Avatar for Richard Dawkins Foundation 21. Richard Dawkins Foundation 1 pt. 8,439
  2. Avatar for Dutch Power Cows 22. Dutch Power Cows 1 pt. 8,149
  1. Avatar for alwan2018 101. alwan2018 Lv 1 1 pt. 9,292
  2. Avatar for WBarme1234 102. WBarme1234 Lv 1 1 pt. 9,278
  3. Avatar for Anfinsen_slept_here 103. Anfinsen_slept_here Lv 1 1 pt. 9,242
  4. Avatar for lconor 104. lconor Lv 1 1 pt. 9,218
  5. Avatar for carsonfb 105. carsonfb Lv 1 1 pt. 9,213
  6. Avatar for pfirth 106. pfirth Lv 1 1 pt. 9,202
  7. Avatar for Knoblerine 107. Knoblerine Lv 1 1 pt. 9,189
  8. Avatar for NotJim99 108. NotJim99 Lv 1 1 pt. 9,168
  9. Avatar for isaksson 109. isaksson Lv 1 1 pt. 9,167
  10. Avatar for Anamfija 110. Anamfija Lv 1 1 pt. 9,143

Comments