Placeholder image of a protein
Icon representing a puzzle

1642: Revisiting Puzzle 111: Mouse

Closed since about 7 years ago

Novice Overall Prediction

Summary


Created
February 27, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups


  1. Avatar for Dutch Power Cows 22. Dutch Power Cows 1 pt. 8,149

  1. Avatar for microversallabs 121. microversallabs Lv 1 1 pt. 9,055
  2. Avatar for leethobbit 122. leethobbit Lv 1 1 pt. 9,055
  3. Avatar for simmons.c.ltcc 123. simmons.c.ltcc Lv 1 1 pt. 9,053
  4. Avatar for benz888 124. benz888 Lv 1 1 pt. 9,038
  5. Avatar for wozzarelli 125. wozzarelli Lv 1 1 pt. 9,010
  6. Avatar for hlfungac 126. hlfungac Lv 1 1 pt. 8,999
  7. Avatar for doctaven 127. doctaven Lv 1 1 pt. 8,997
  8. Avatar for ironchefnorse 128. ironchefnorse Lv 1 1 pt. 8,988
  9. Avatar for hajtogato 129. hajtogato Lv 1 1 pt. 8,976
  10. Avatar for Znaika 130. Znaika Lv 1 1 pt. 8,956

Comments