Placeholder image of a protein
Icon representing a puzzle

1642: Revisiting Puzzle 111: Mouse

Closed since about 7 years ago

Novice Novice Overall Overall Prediction Prediction

Summary

Created
February 27, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups

  1. Avatar for Richard Dawkins Foundation 21. Richard Dawkins Foundation 1 pt. 8,439
  2. Avatar for Dutch Power Cows 22. Dutch Power Cows 1 pt. 8,149
  1. Avatar for multaq 131. multaq Lv 1 1 pt. 8,918
  2. Avatar for henur 132. henur Lv 1 1 pt. 8,875
  3. Avatar for hexidecimalhack 133. hexidecimalhack Lv 1 1 pt. 8,838
  4. Avatar for jeremiasivan 134. jeremiasivan Lv 1 1 pt. 8,837
  5. Avatar for kvasirthewise 135. kvasirthewise Lv 1 1 pt. 8,822
  6. Avatar for JCramer23gtq 136. JCramer23gtq Lv 1 1 pt. 8,759
  7. Avatar for cenkonur 137. cenkonur Lv 1 1 pt. 8,649
  8. Avatar for AndrewBuck 138. AndrewBuck Lv 1 1 pt. 8,439
  9. Avatar for Tehnologik1 139. Tehnologik1 Lv 1 1 pt. 8,370
  10. Avatar for mrfu 140. mrfu Lv 1 1 pt. 8,149

Comments