Placeholder image of a protein
Icon representing a puzzle

1642: Revisiting Puzzle 111: Mouse

Closed since about 7 years ago

Novice Novice Overall Overall Prediction Prediction

Summary

Created
February 27, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups

  1. Avatar for Richard Dawkins Foundation 21. Richard Dawkins Foundation 1 pt. 8,439
  2. Avatar for Dutch Power Cows 22. Dutch Power Cows 1 pt. 8,149
  1. Avatar for lesi 141. lesi Lv 1 1 pt. 8,093
  2. Avatar for RockOn 142. RockOn Lv 1 1 pt. 7,861
  3. Avatar for tasman 143. tasman Lv 1 1 pt. 7,220
  4. Avatar for kangchingfan 144. kangchingfan Lv 1 1 pt. 6,864
  5. Avatar for s5060557 145. s5060557 Lv 1 1 pt. 6,687
  6. Avatar for anthion 146. anthion Lv 1 1 pt. 5,020
  7. Avatar for JMStiffler 147. JMStiffler Lv 1 1 pt. 5,020
  8. Avatar for Ribo-soma 148. Ribo-soma Lv 1 1 pt. 5,020
  9. Avatar for 181818 149. 181818 Lv 1 1 pt. 5,020
  10. Avatar for evapsy 150. evapsy Lv 1 1 pt. 5,020

Comments