Placeholder image of a protein
Icon representing a puzzle

1642: Revisiting Puzzle 111: Mouse

Closed since about 7 years ago

Novice Overall Prediction

Summary


Created
February 27, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups


  1. Avatar for Dutch Power Cows 22. Dutch Power Cows 1 pt. 8,149

  1. Avatar for dcrwheeler 11. dcrwheeler Lv 1 71 pts. 9,772
  2. Avatar for smilingone 12. smilingone Lv 1 69 pts. 9,770
  3. Avatar for YeshuaLives 13. YeshuaLives Lv 1 66 pts. 9,770
  4. Avatar for frood66 14. frood66 Lv 1 64 pts. 9,769
  5. Avatar for cbwest 15. cbwest Lv 1 62 pts. 9,757
  6. Avatar for fiendish_ghoul 16. fiendish_ghoul Lv 1 59 pts. 9,754
  7. Avatar for NinjaGreg 17. NinjaGreg Lv 1 57 pts. 9,748
  8. Avatar for reefyrob 18. reefyrob Lv 1 55 pts. 9,746
  9. Avatar for Deleted player 19. Deleted player 53 pts. 9,745
  10. Avatar for nicobul 20. nicobul Lv 1 51 pts. 9,745

Comments