Placeholder image of a protein
Icon representing a puzzle

1642: Revisiting Puzzle 111: Mouse

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
February 27, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups

  1. Avatar for Richard Dawkins Foundation 21. Richard Dawkins Foundation 1 pt. 8,439
  2. Avatar for Dutch Power Cows 22. Dutch Power Cows 1 pt. 8,149
  1. Avatar for robgee 31. robgee Lv 1 33 pts. 9,677
  2. Avatar for grogar7 32. grogar7 Lv 1 32 pts. 9,673
  3. Avatar for gurch 33. gurch Lv 1 30 pts. 9,673
  4. Avatar for O Seki To 34. O Seki To Lv 1 29 pts. 9,670
  5. Avatar for stomjoh 35. stomjoh Lv 1 28 pts. 9,666
  6. Avatar for tarimo 36. tarimo Lv 1 27 pts. 9,664
  7. Avatar for christioanchauvin 37. christioanchauvin Lv 1 26 pts. 9,662
  8. Avatar for aznarog 38. aznarog Lv 1 24 pts. 9,662
  9. Avatar for georg137 39. georg137 Lv 1 23 pts. 9,653
  10. Avatar for johnmitch 40. johnmitch Lv 1 22 pts. 9,647

Comments