Placeholder image of a protein
Icon representing a puzzle

1642: Revisiting Puzzle 111: Mouse

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
February 27, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups

  1. Avatar for Richard Dawkins Foundation 21. Richard Dawkins Foundation 1 pt. 8,439
  2. Avatar for Dutch Power Cows 22. Dutch Power Cows 1 pt. 8,149
  1. Avatar for rezaefar 61. rezaefar Lv 1 8 pts. 9,544
  2. Avatar for hada 62. hada Lv 1 8 pts. 9,525
  3. Avatar for Crossed Sticks 63. Crossed Sticks Lv 1 7 pts. 9,521
  4. Avatar for benrh 64. benrh Lv 1 7 pts. 9,519
  5. Avatar for dbuske 65. dbuske Lv 1 7 pts. 9,517
  6. Avatar for Sissue 66. Sissue Lv 1 6 pts. 9,513
  7. Avatar for Hellcat6 67. Hellcat6 Lv 1 6 pts. 9,502
  8. Avatar for diamonddays 68. diamonddays Lv 1 6 pts. 9,499
  9. Avatar for alcor29 69. alcor29 Lv 1 5 pts. 9,498
  10. Avatar for heather-1 70. heather-1 Lv 1 5 pts. 9,495

Comments