Placeholder image of a protein
Icon representing a puzzle

1642: Revisiting Puzzle 111: Mouse

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
February 27, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups

  1. Avatar for Richard Dawkins Foundation 21. Richard Dawkins Foundation 1 pt. 8,439
  2. Avatar for Dutch Power Cows 22. Dutch Power Cows 1 pt. 8,149
  1. Avatar for Wipf 71. Wipf Lv 1 5 pts. 9,486
  2. Avatar for Lyshi2018 72. Lyshi2018 Lv 1 4 pts. 9,482
  3. Avatar for alwen 73. alwen Lv 1 4 pts. 9,477
  4. Avatar for TastyMunchies 74. TastyMunchies Lv 1 4 pts. 9,474
  5. Avatar for JasperD 75. JasperD Lv 1 4 pts. 9,462
  6. Avatar for fpc 76. fpc Lv 1 4 pts. 9,460
  7. Avatar for Cagdason 77. Cagdason Lv 1 3 pts. 9,460
  8. Avatar for Alpha-KetoGlutarate1301 78. Alpha-KetoGlutarate1301 Lv 1 3 pts. 9,459
  9. Avatar for Arne Heessels 79. Arne Heessels Lv 1 3 pts. 9,457
  10. Avatar for Altercomp 80. Altercomp Lv 1 3 pts. 9,456

Comments