Placeholder image of a protein
Icon representing a puzzle

1642: Revisiting Puzzle 111: Mouse

Closed since about 7 years ago

Novice Novice Overall Overall Prediction Prediction

Summary


Created
February 27, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups


  1. Avatar for Dutch Power Cows 22. Dutch Power Cows 1 pt. 8,149

  1. Avatar for vizhu2018 81. vizhu2018 Lv 1 3 pts. 9,452
  2. Avatar for roman madala 82. roman madala Lv 1 2 pts. 9,449
  3. Avatar for Merf 83. Merf Lv 1 2 pts. 9,433
  4. Avatar for RyeSnake 84. RyeSnake Lv 1 2 pts. 9,424
  5. Avatar for harvardman 85. harvardman Lv 1 2 pts. 9,418
  6. Avatar for jausmh 86. jausmh Lv 1 2 pts. 9,416
  7. Avatar for drjr 87. drjr Lv 1 2 pts. 9,404
  8. Avatar for ppp6 88. ppp6 Lv 1 2 pts. 9,398
  9. Avatar for frostschutz 89. frostschutz Lv 1 2 pts. 9,395
  10. Avatar for rinze 90. rinze Lv 1 2 pts. 9,380

Comments