Placeholder image of a protein
Icon representing a puzzle

1646: Unsolved De-novo Freestyle 148

Closed since about 7 years ago

Intermediate Overall Prediction

Summary

Created
March 07, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PKIVIVIVYDTIVIVIVFDGDEVVIVIVVDNRKYEVRLKGTDWEEVRKVLKEMVKKIGGKKLKEMVDKVM

Top groups

  1. Avatar for GENE 433 11. GENE 433 2 pts. 9,508
  2. Avatar for Hold My Beer 12. Hold My Beer 1 pt. 9,339
  3. Avatar for freefolder 13. freefolder 1 pt. 9,278
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 8,820
  5. Avatar for FoldIt@Poland 15. FoldIt@Poland 1 pt. 8,620
  6. Avatar for Androids 16. Androids 1 pt. 8,255
  7. Avatar for DW 2020 17. DW 2020 1 pt. 8,009
  8. Avatar for I3L GANG 18. I3L GANG 1 pt. 7,938
  9. Avatar for Dutch Power Cows 19. Dutch Power Cows 1 pt. 0
  1. Avatar for RockOn 91. RockOn Lv 1 1 pt. 8,580
  2. Avatar for momadoc 92. momadoc Lv 1 1 pt. 8,571
  3. Avatar for pfirth 93. pfirth Lv 1 1 pt. 8,554
  4. Avatar for hajtogato 94. hajtogato Lv 1 1 pt. 8,455
  5. Avatar for lconor 95. lconor Lv 1 1 pt. 8,375
  6. Avatar for hexidecimalhack 96. hexidecimalhack Lv 1 1 pt. 8,359
  7. Avatar for multaq 97. multaq Lv 1 1 pt. 8,269
  8. Avatar for rinze 98. rinze Lv 1 1 pt. 8,221
  9. Avatar for Philippe_C 99. Philippe_C Lv 1 1 pt. 8,207
  10. Avatar for petetrig 100. petetrig Lv 1 1 pt. 8,186

Comments