Placeholder image of a protein
Icon representing a puzzle

1646: Unsolved De-novo Freestyle 148

Closed since about 7 years ago

Intermediate Overall Prediction

Summary

Created
March 07, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PKIVIVIVYDTIVIVIVFDGDEVVIVIVVDNRKYEVRLKGTDWEEVRKVLKEMVKKIGGKKLKEMVDKVM

Top groups

  1. Avatar for GENE 433 11. GENE 433 2 pts. 9,508
  2. Avatar for Hold My Beer 12. Hold My Beer 1 pt. 9,339
  3. Avatar for freefolder 13. freefolder 1 pt. 9,278
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 8,820
  5. Avatar for FoldIt@Poland 15. FoldIt@Poland 1 pt. 8,620
  6. Avatar for Androids 16. Androids 1 pt. 8,255
  7. Avatar for DW 2020 17. DW 2020 1 pt. 8,009
  8. Avatar for I3L GANG 18. I3L GANG 1 pt. 7,938
  9. Avatar for Dutch Power Cows 19. Dutch Power Cows 1 pt. 0
  1. Avatar for MrZanav 101. MrZanav Lv 1 1 pt. 8,179
  2. Avatar for Vincera 102. Vincera Lv 1 1 pt. 8,117
  3. Avatar for Alistair69 103. Alistair69 Lv 1 1 pt. 8,015
  4. Avatar for Lyshi2018 104. Lyshi2018 Lv 1 1 pt. 8,009
  5. Avatar for alwan2018 105. alwan2018 Lv 1 1 pt. 8,001
  6. Avatar for Knoblerine 106. Knoblerine Lv 1 1 pt. 7,939
  7. Avatar for benz888 107. benz888 Lv 1 1 pt. 7,938
  8. Avatar for P-51 Mustang 108. P-51 Mustang Lv 1 1 pt. 7,920
  9. Avatar for Zainul0103 109. Zainul0103 Lv 1 1 pt. 7,919
  10. Avatar for NinguLilium 110. NinguLilium Lv 1 1 pt. 7,867

Comments