Placeholder image of a protein
Icon representing a puzzle

1646: Unsolved De-novo Freestyle 148

Closed since about 7 years ago

Intermediate Overall Prediction

Summary

Created
March 07, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PKIVIVIVYDTIVIVIVFDGDEVVIVIVVDNRKYEVRLKGTDWEEVRKVLKEMVKKIGGKKLKEMVDKVM

Top groups

  1. Avatar for GENE 433 11. GENE 433 2 pts. 9,508
  2. Avatar for Hold My Beer 12. Hold My Beer 1 pt. 9,339
  3. Avatar for freefolder 13. freefolder 1 pt. 9,278
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 8,820
  5. Avatar for FoldIt@Poland 15. FoldIt@Poland 1 pt. 8,620
  6. Avatar for Androids 16. Androids 1 pt. 8,255
  7. Avatar for DW 2020 17. DW 2020 1 pt. 8,009
  8. Avatar for I3L GANG 18. I3L GANG 1 pt. 7,938
  9. Avatar for Dutch Power Cows 19. Dutch Power Cows 1 pt. 0
  1. Avatar for WBarme1234 41. WBarme1234 Lv 1 20 pts. 9,681
  2. Avatar for phi16 42. phi16 Lv 1 19 pts. 9,678
  3. Avatar for Deleted player 43. Deleted player pts. 9,671
  4. Avatar for aznarog 44. aznarog Lv 1 18 pts. 9,656
  5. Avatar for alwen 45. alwen Lv 1 17 pts. 9,654
  6. Avatar for joremen 46. joremen Lv 1 16 pts. 9,640
  7. Avatar for Anfinsen_slept_here 47. Anfinsen_slept_here Lv 1 15 pts. 9,627
  8. Avatar for johnmitch 48. johnmitch Lv 1 15 pts. 9,624
  9. Avatar for heather-1 49. heather-1 Lv 1 14 pts. 9,572
  10. Avatar for spvincent 50. spvincent Lv 1 13 pts. 9,569

Comments