Placeholder image of a protein
Icon representing a puzzle

1646: Unsolved De-novo Freestyle 148

Closed since about 7 years ago

Intermediate Overall Prediction

Summary

Created
March 07, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PKIVIVIVYDTIVIVIVFDGDEVVIVIVVDNRKYEVRLKGTDWEEVRKVLKEMVKKIGGKKLKEMVDKVM

Top groups

  1. Avatar for GENE 433 11. GENE 433 2 pts. 9,508
  2. Avatar for Hold My Beer 12. Hold My Beer 1 pt. 9,339
  3. Avatar for freefolder 13. freefolder 1 pt. 9,278
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 8,820
  5. Avatar for FoldIt@Poland 15. FoldIt@Poland 1 pt. 8,620
  6. Avatar for Androids 16. Androids 1 pt. 8,255
  7. Avatar for DW 2020 17. DW 2020 1 pt. 8,009
  8. Avatar for I3L GANG 18. I3L GANG 1 pt. 7,938
  9. Avatar for Dutch Power Cows 19. Dutch Power Cows 1 pt. 0
  1. Avatar for Deleted player 51. Deleted player 13 pts. 9,556
  2. Avatar for harvardman 52. harvardman Lv 1 12 pts. 9,537
  3. Avatar for jamiexq 53. jamiexq Lv 1 11 pts. 9,528
  4. Avatar for orily1337 54. orily1337 Lv 1 11 pts. 9,514
  5. Avatar for Cagdason 55. Cagdason Lv 1 10 pts. 9,508
  6. Avatar for tarimo 56. tarimo Lv 1 10 pts. 9,490
  7. Avatar for timroberts16 57. timroberts16 Lv 1 9 pts. 9,480
  8. Avatar for Crossed Sticks 58. Crossed Sticks Lv 1 9 pts. 9,437
  9. Avatar for benrh 59. benrh Lv 1 8 pts. 9,433
  10. Avatar for boondog 60. boondog Lv 1 8 pts. 9,403

Comments