Placeholder image of a protein
Icon representing a puzzle

1646: Unsolved De-novo Freestyle 148

Closed since about 7 years ago

Intermediate Overall Prediction

Summary

Created
March 07, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PKIVIVIVYDTIVIVIVFDGDEVVIVIVVDNRKYEVRLKGTDWEEVRKVLKEMVKKIGGKKLKEMVDKVM

Top groups

  1. Avatar for GENE 433 11. GENE 433 2 pts. 9,508
  2. Avatar for Hold My Beer 12. Hold My Beer 1 pt. 9,339
  3. Avatar for freefolder 13. freefolder 1 pt. 9,278
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 8,820
  5. Avatar for FoldIt@Poland 15. FoldIt@Poland 1 pt. 8,620
  6. Avatar for Androids 16. Androids 1 pt. 8,255
  7. Avatar for DW 2020 17. DW 2020 1 pt. 8,009
  8. Avatar for I3L GANG 18. I3L GANG 1 pt. 7,938
  9. Avatar for Dutch Power Cows 19. Dutch Power Cows 1 pt. 0
  1. Avatar for fpc 61. fpc Lv 1 7 pts. 9,389
  2. Avatar for Aminal88 62. Aminal88 Lv 1 7 pts. 9,339
  3. Avatar for Maerlyn138 63. Maerlyn138 Lv 1 7 pts. 9,331
  4. Avatar for Tehnologik1 64. Tehnologik1 Lv 1 6 pts. 9,330
  5. Avatar for jausmh 65. jausmh Lv 1 6 pts. 9,279
  6. Avatar for Altercomp 66. Altercomp Lv 1 6 pts. 9,278
  7. Avatar for Merf 67. Merf Lv 1 5 pts. 9,274
  8. Avatar for Bletchley Park 68. Bletchley Park Lv 1 5 pts. 9,250
  9. Avatar for DoctorSockrates 69. DoctorSockrates Lv 1 5 pts. 9,232
  10. Avatar for alcor29 70. alcor29 Lv 1 4 pts. 9,207

Comments