Placeholder image of a protein
Icon representing a puzzle

1646: Unsolved De-novo Freestyle 148

Closed since about 7 years ago

Intermediate Overall Prediction

Summary

Created
March 07, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PKIVIVIVYDTIVIVIVFDGDEVVIVIVVDNRKYEVRLKGTDWEEVRKVLKEMVKKIGGKKLKEMVDKVM

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,361
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 76 pts. 10,353
  3. Avatar for Gargleblasters 3. Gargleblasters 56 pts. 10,304
  4. Avatar for Go Science 4. Go Science 41 pts. 10,058
  5. Avatar for Contenders 5. Contenders 29 pts. 10,026
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 20 pts. 9,997
  7. Avatar for Marvin's bunch 7. Marvin's bunch 14 pts. 9,947
  8. Avatar for Russian team 8. Russian team 9 pts. 9,931
  9. Avatar for Void Crushers 9. Void Crushers 6 pts. 9,907
  10. Avatar for HMT heritage 10. HMT heritage 4 pts. 9,815
  1. Avatar for rabamino12358 81. rabamino12358 Lv 1 2 pts. 8,924
  2. Avatar for ViJay7019 82. ViJay7019 Lv 1 2 pts. 8,867
  3. Avatar for JasperD 83. JasperD Lv 1 2 pts. 8,820
  4. Avatar for YGK 84. YGK Lv 1 2 pts. 8,810
  5. Avatar for ManVsYard 85. ManVsYard Lv 1 2 pts. 8,757
  6. Avatar for rezaefar 86. rezaefar Lv 1 2 pts. 8,732
  7. Avatar for Jesse Pinkman 87. Jesse Pinkman Lv 1 2 pts. 8,706
  8. Avatar for RyeSnake 88. RyeSnake Lv 1 2 pts. 8,701
  9. Avatar for Psych0Active 89. Psych0Active Lv 1 1 pt. 8,656
  10. Avatar for oureion 90. oureion Lv 1 1 pt. 8,620

Comments