Placeholder image of a protein
Icon representing a puzzle

1646: Unsolved De-novo Freestyle 148

Closed since about 7 years ago

Intermediate Overall Prediction

Summary

Created
March 07, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PKIVIVIVYDTIVIVIVFDGDEVVIVIVVDNRKYEVRLKGTDWEEVRKVLKEMVKKIGGKKLKEMVDKVM

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,361
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 76 pts. 10,353
  3. Avatar for Gargleblasters 3. Gargleblasters 56 pts. 10,304
  4. Avatar for Go Science 4. Go Science 41 pts. 10,058
  5. Avatar for Contenders 5. Contenders 29 pts. 10,026
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 20 pts. 9,997
  7. Avatar for Marvin's bunch 7. Marvin's bunch 14 pts. 9,947
  8. Avatar for Russian team 8. Russian team 9 pts. 9,931
  9. Avatar for Void Crushers 9. Void Crushers 6 pts. 9,907
  10. Avatar for HMT heritage 10. HMT heritage 4 pts. 9,815
  1. Avatar for Arne Heessels 71. Arne Heessels Lv 1 4 pts. 9,196
  2. Avatar for navn 72. navn Lv 1 4 pts. 9,156
  3. Avatar for diamonddays 73. diamonddays Lv 1 4 pts. 9,082
  4. Avatar for Rastamasta 74. Rastamasta Lv 1 4 pts. 9,075
  5. Avatar for joaniegirl 75. joaniegirl Lv 1 3 pts. 9,037
  6. Avatar for Flagg65a 76. Flagg65a Lv 1 3 pts. 9,002
  7. Avatar for stomjoh 77. stomjoh Lv 1 3 pts. 8,990
  8. Avatar for MicElephant 78. MicElephant Lv 1 3 pts. 8,981
  9. Avatar for Hellcat6 79. Hellcat6 Lv 1 3 pts. 8,975
  10. Avatar for Squirrely 80. Squirrely Lv 1 2 pts. 8,934

Comments