Placeholder image of a protein
Icon representing a puzzle

1648: Revisiting Puzzle 113: White Birch

Closed since almost 7 years ago

Novice Overall Prediction

Summary

Created
March 13, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups

  1. Avatar for GENE 433 11. GENE 433 4 pts. 10,394
  2. Avatar for DW 2020 12. DW 2020 3 pts. 10,216
  3. Avatar for Hold My Beer 13. Hold My Beer 2 pts. 10,122
  4. Avatar for FoldIt@Poland 14. FoldIt@Poland 1 pt. 9,900
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 9,724
  6. Avatar for Deleted group 16. Deleted group pts. 9,628
  7. Avatar for freefolder 17. freefolder 1 pt. 9,583
  8. Avatar for Dutch Power Cows 18. Dutch Power Cows 1 pt. 9,490
  9. Avatar for Team South Africa 19. Team South Africa 1 pt. 9,219
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 9,109
  1. Avatar for grogar7
    1. grogar7 Lv 1
    100 pts. 10,906
  2. Avatar for Deleted player 2. Deleted player 97 pts. 10,890
  3. Avatar for tyler0911 3. tyler0911 Lv 1 94 pts. 10,872
  4. Avatar for crpainter 4. crpainter Lv 1 91 pts. 10,858
  5. Avatar for Aubade01 5. Aubade01 Lv 1 87 pts. 10,854
  6. Avatar for smilingone 6. smilingone Lv 1 84 pts. 10,840
  7. Avatar for georg137 7. georg137 Lv 1 81 pts. 10,830
  8. Avatar for robgee 8. robgee Lv 1 79 pts. 10,809
  9. Avatar for johnmitch 9. johnmitch Lv 1 76 pts. 10,804
  10. Avatar for Bruno Kestemont 10. Bruno Kestemont Lv 1 73 pts. 10,796

Comments