Placeholder image of a protein
Icon representing a puzzle

1648: Revisiting Puzzle 113: White Birch

Closed since almost 7 years ago

Novice Overall Prediction

Summary

Created
March 13, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups

  1. Avatar for Rechenkraft.net 21. Rechenkraft.net 1 pt. 9,041
  2. Avatar for SHELL 22. SHELL 1 pt. 5,520
  1. Avatar for grogar7
    1. grogar7 Lv 1
    100 pts. 10,906
  2. Avatar for Deleted player 2. Deleted player 97 pts. 10,890
  3. Avatar for tyler0911 3. tyler0911 Lv 1 94 pts. 10,872
  4. Avatar for crpainter 4. crpainter Lv 1 91 pts. 10,858
  5. Avatar for Aubade01 5. Aubade01 Lv 1 87 pts. 10,854
  6. Avatar for smilingone 6. smilingone Lv 1 84 pts. 10,840
  7. Avatar for georg137 7. georg137 Lv 1 81 pts. 10,830
  8. Avatar for robgee 8. robgee Lv 1 79 pts. 10,809
  9. Avatar for johnmitch 9. johnmitch Lv 1 76 pts. 10,804
  10. Avatar for Bruno Kestemont 10. Bruno Kestemont Lv 1 73 pts. 10,796

Comments