Placeholder image of a protein
Icon representing a puzzle

1648: Revisiting Puzzle 113: White Birch

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
March 13, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups

  1. Avatar for GENE 433 11. GENE 433 4 pts. 10,394
  2. Avatar for DW 2020 12. DW 2020 3 pts. 10,216
  3. Avatar for Hold My Beer 13. Hold My Beer 2 pts. 10,122
  4. Avatar for FoldIt@Poland 14. FoldIt@Poland 1 pt. 9,900
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 9,724
  6. Avatar for Deleted group 16. Deleted group pts. 9,628
  7. Avatar for freefolder 17. freefolder 1 pt. 9,583
  8. Avatar for Dutch Power Cows 18. Dutch Power Cows 1 pt. 9,490
  9. Avatar for Team South Africa 19. Team South Africa 1 pt. 9,219
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 9,109
  1. Avatar for pfirth 101. pfirth Lv 1 1 pt. 9,841
  2. Avatar for @lison 102. @lison Lv 1 1 pt. 9,836
  3. Avatar for Kevonni 103. Kevonni Lv 1 1 pt. 9,803
  4. Avatar for 181818 104. 181818 Lv 1 1 pt. 9,791
  5. Avatar for congautruc 105. congautruc Lv 1 1 pt. 9,770
  6. Avatar for hexidecimalhack 106. hexidecimalhack Lv 1 1 pt. 9,753
  7. Avatar for Wipf 107. Wipf Lv 1 1 pt. 9,752
  8. Avatar for JasperD 108. JasperD Lv 1 1 pt. 9,724
  9. Avatar for wozzarelli 109. wozzarelli Lv 1 1 pt. 9,706
  10. Avatar for Mao Mao 110. Mao Mao Lv 1 1 pt. 9,695

Comments