Placeholder image of a protein
Icon representing a puzzle

1648: Revisiting Puzzle 113: White Birch

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
March 13, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups

  1. Avatar for GENE 433 11. GENE 433 4 pts. 10,394
  2. Avatar for DW 2020 12. DW 2020 3 pts. 10,216
  3. Avatar for Hold My Beer 13. Hold My Beer 2 pts. 10,122
  4. Avatar for FoldIt@Poland 14. FoldIt@Poland 1 pt. 9,900
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 9,724
  6. Avatar for Deleted group 16. Deleted group pts. 9,628
  7. Avatar for freefolder 17. freefolder 1 pt. 9,583
  8. Avatar for Dutch Power Cows 18. Dutch Power Cows 1 pt. 9,490
  9. Avatar for Team South Africa 19. Team South Africa 1 pt. 9,219
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 9,109
  1. Avatar for alcor29 31. alcor29 Lv 1 32 pts. 10,637
  2. Avatar for frood66 32. frood66 Lv 1 31 pts. 10,634
  3. Avatar for Deleted player 33. Deleted player pts. 10,634
  4. Avatar for jausmh 34. jausmh Lv 1 28 pts. 10,613
  5. Avatar for aznarog 35. aznarog Lv 1 27 pts. 10,608
  6. Avatar for cbwest 36. cbwest Lv 1 26 pts. 10,606
  7. Avatar for Idiotboy 37. Idiotboy Lv 1 25 pts. 10,594
  8. Avatar for fpc 38. fpc Lv 1 23 pts. 10,591
  9. Avatar for joremen 39. joremen Lv 1 22 pts. 10,588
  10. Avatar for WBarme1234 40. WBarme1234 Lv 1 21 pts. 10,580

Comments