Placeholder image of a protein
Icon representing a puzzle

1648: Revisiting Puzzle 113: White Birch

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
March 13, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups

  1. Avatar for Rechenkraft.net 21. Rechenkraft.net 1 pt. 9,041
  2. Avatar for SHELL 22. SHELL 1 pt. 5,520
  1. Avatar for xbp 91. xbp Lv 1 1 pt. 10,006
  2. Avatar for DoctorSockrates 92. DoctorSockrates Lv 1 1 pt. 9,989
  3. Avatar for Lyshi2018 93. Lyshi2018 Lv 1 1 pt. 9,952
  4. Avatar for Alpha-KetoGlutarate1301 94. Alpha-KetoGlutarate1301 Lv 1 1 pt. 9,936
  5. Avatar for RootBeerSwordsman 95. RootBeerSwordsman Lv 1 1 pt. 9,927
  6. Avatar for oureion 96. oureion Lv 1 1 pt. 9,900
  7. Avatar for ivalnic 97. ivalnic Lv 1 1 pt. 9,880
  8. Avatar for felixxy 98. felixxy Lv 1 1 pt. 9,857
  9. Avatar for kludbrook 99. kludbrook Lv 1 1 pt. 9,848
  10. Avatar for alwan2018 100. alwan2018 Lv 1 1 pt. 9,842

Comments