Placeholder image of a protein
Icon representing a puzzle

1648: Revisiting Puzzle 113: White Birch

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
March 13, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups

  1. Avatar for Rechenkraft.net 21. Rechenkraft.net 1 pt. 9,041
  2. Avatar for SHELL 22. SHELL 1 pt. 5,520
  1. Avatar for mrfu 121. mrfu Lv 1 1 pt. 9,490
  2. Avatar for dataco79 122. dataco79 Lv 1 1 pt. 9,471
  3. Avatar for jdmclure 123. jdmclure Lv 1 1 pt. 9,405
  4. Avatar for Vincera 124. Vincera Lv 1 1 pt. 9,404
  5. Avatar for ProtiwanKenfoldi 125. ProtiwanKenfoldi Lv 1 1 pt. 9,301
  6. Avatar for serotonina 126. serotonina Lv 1 1 pt. 9,277
  7. Avatar for Simek 127. Simek Lv 1 1 pt. 9,254
  8. Avatar for Zlyden 128. Zlyden Lv 1 1 pt. 9,252
  9. Avatar for Ardbegger 129. Ardbegger Lv 1 1 pt. 9,228
  10. Avatar for doctaven 130. doctaven Lv 1 1 pt. 9,219

Comments