Placeholder image of a protein
Icon representing a puzzle

1648: Revisiting Puzzle 113: White Birch

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
March 13, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups

  1. Avatar for Rechenkraft.net 21. Rechenkraft.net 1 pt. 9,041
  2. Avatar for SHELL 22. SHELL 1 pt. 5,520
  1. Avatar for O Seki To 11. O Seki To Lv 1 70 pts. 10,795
  2. Avatar for LociOiling 12. LociOiling Lv 1 68 pts. 10,786
  3. Avatar for Galaxie 13. Galaxie Lv 1 65 pts. 10,767
  4. Avatar for ZeroLeak7 14. ZeroLeak7 Lv 1 63 pts. 10,763
  5. Avatar for Phyx 15. Phyx Lv 1 61 pts. 10,752
  6. Avatar for Timo van der Laan 16. Timo van der Laan Lv 1 58 pts. 10,749
  7. Avatar for fiendish_ghoul 17. fiendish_ghoul Lv 1 56 pts. 10,746
  8. Avatar for pvc78 18. pvc78 Lv 1 54 pts. 10,745
  9. Avatar for retiredmichael 19. retiredmichael Lv 1 52 pts. 10,731
  10. Avatar for jobo0502 20. jobo0502 Lv 1 50 pts. 10,725

Comments