Placeholder image of a protein
Icon representing a puzzle

1648: Revisiting Puzzle 113: White Birch

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
March 13, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups

  1. Avatar for Rechenkraft.net 21. Rechenkraft.net 1 pt. 9,041
  2. Avatar for SHELL 22. SHELL 1 pt. 5,520
  1. Avatar for reefyrob 21. reefyrob Lv 1 48 pts. 10,722
  2. Avatar for vakobo 22. vakobo Lv 1 46 pts. 10,719
  3. Avatar for nicobul 23. nicobul Lv 1 44 pts. 10,714
  4. Avatar for silent gene 24. silent gene Lv 1 43 pts. 10,713
  5. Avatar for dcrwheeler 25. dcrwheeler Lv 1 41 pts. 10,701
  6. Avatar for Skippysk8s 26. Skippysk8s Lv 1 39 pts. 10,699
  7. Avatar for Deleted player 27. Deleted player pts. 10,687
  8. Avatar for christioanchauvin 28. christioanchauvin Lv 1 36 pts. 10,687
  9. Avatar for Blipperman 29. Blipperman Lv 1 35 pts. 10,665
  10. Avatar for phi16 30. phi16 Lv 1 33 pts. 10,644

Comments