Placeholder image of a protein
Icon representing a puzzle

1648: Revisiting Puzzle 113: White Birch

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
March 13, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups

  1. Avatar for Rechenkraft.net 21. Rechenkraft.net 1 pt. 9,041
  2. Avatar for SHELL 22. SHELL 1 pt. 5,520
  1. Avatar for alcor29 31. alcor29 Lv 1 32 pts. 10,637
  2. Avatar for frood66 32. frood66 Lv 1 31 pts. 10,634
  3. Avatar for Deleted player 33. Deleted player pts. 10,634
  4. Avatar for jausmh 34. jausmh Lv 1 28 pts. 10,613
  5. Avatar for aznarog 35. aznarog Lv 1 27 pts. 10,608
  6. Avatar for cbwest 36. cbwest Lv 1 26 pts. 10,606
  7. Avatar for Idiotboy 37. Idiotboy Lv 1 25 pts. 10,594
  8. Avatar for fpc 38. fpc Lv 1 23 pts. 10,591
  9. Avatar for joremen 39. joremen Lv 1 22 pts. 10,588
  10. Avatar for WBarme1234 40. WBarme1234 Lv 1 21 pts. 10,580

Comments