Placeholder image of a protein
Icon representing a puzzle

1648: Revisiting Puzzle 113: White Birch

Closed since about 7 years ago

Novice Overall Prediction

Summary

Created
March 13, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups

  1. Avatar for Rechenkraft.net 21. Rechenkraft.net 1 pt. 9,041
  2. Avatar for SHELL 22. SHELL 1 pt. 5,520
  1. Avatar for Maerlyn138 51. Maerlyn138 Lv 1 13 pts. 10,428
  2. Avatar for lconor 52. lconor Lv 1 12 pts. 10,418
  3. Avatar for TastyMunchies 53. TastyMunchies Lv 1 11 pts. 10,408
  4. Avatar for rezaefar 54. rezaefar Lv 1 11 pts. 10,395
  5. Avatar for Cagdason 55. Cagdason Lv 1 10 pts. 10,394
  6. Avatar for Merf 56. Merf Lv 1 10 pts. 10,368
  7. Avatar for jamiexq 57. jamiexq Lv 1 9 pts. 10,363
  8. Avatar for Sissue 58. Sissue Lv 1 9 pts. 10,351
  9. Avatar for poiuytrewq987 59. poiuytrewq987 Lv 1 8 pts. 10,317
  10. Avatar for carsonfb 60. carsonfb Lv 1 8 pts. 10,312

Comments