Placeholder image of a protein
Icon representing a puzzle

1648: Revisiting Puzzle 113: White Birch

Closed since about 7 years ago

Novice Overall Prediction

Summary


Created
March 13, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups


  1. Avatar for Rechenkraft.net 21. Rechenkraft.net 1 pt. 9,041
  2. Avatar for SHELL 22. SHELL 1 pt. 5,520

  1. Avatar for timroberts16 61. timroberts16 Lv 1 7 pts. 10,306
  2. Avatar for Vinara 62. Vinara Lv 1 7 pts. 10,305
  3. Avatar for Natuhaka 63. Natuhaka Lv 1 7 pts. 10,299
  4. Avatar for diamonddays 64. diamonddays Lv 1 6 pts. 10,281
  5. Avatar for heather-1 65. heather-1 Lv 1 6 pts. 10,271
  6. Avatar for ViJay7019 66. ViJay7019 Lv 1 6 pts. 10,270
  7. Avatar for altejoh 67. altejoh Lv 1 5 pts. 10,270
  8. Avatar for joaniegirl 68. joaniegirl Lv 1 5 pts. 10,265
  9. Avatar for Rastamasta 69. Rastamasta Lv 1 5 pts. 10,260
  10. Avatar for Glen B 70. Glen B Lv 1 4 pts. 10,252

Comments